How do i do ___ in n8n

digibandit

wrongecho unsure, while I find that for you what are all the fields needed to create a client, contact, ticket and asset via API?

wrongecho

digibandit

itflow-org/itflow-api-powershellblob/main/clients/create.ps1

digibandit

wrongecho yeah I used that as a reference but it still stated I was missing required fields. No idea what fields in missing.

focusflarenetwork

wrongecho also frankly as someone who is still very basic to the industry all of this is like reading french. Any chance we can get some instructions on what to do and where?

focusflarenetwork

holy moses. I was just about to make an n8n thread lol. BLESS. @digibandit did you figure it out? Will it actually create a ticket for you? I switched to Zammad hoping it would be bettet since zammad has a direct n8n connection but it suckw compared to ITflow. I pray someone makes a video on this for other people would want to do it

focusflarenetwork

And if I have to pay for support I will. ItFlow is worth the price imo. Other software just doesnt have the types of stuff ITflow has. its a great for break fix and MSPs/ hybrid of both which is what I am

digibandit

WordPress to ITFlow Integration - Workflow Explanation

Overview

This n8n workflow automatically processes website contact form submissions from WordPress and creates support tickets in ITFlow, your IT management system. It intelligently handles duplicate contacts and ensures clean data entry.

How It Works (Step-by-Step)

1. Website Lead (Webhook Trigger)

Receives POST requests from WordPress contact forms
Acts as the entry point when someone submits a form on your website

2. Sort Data (JavaScript Parser)

Parses incoming form data from multiple WordPress form formats
Handles different field IDs and naming conventions (supports both "old" and "kiosk" form schemas)
Extracts and normalizes:
- Contact information (name, email, phone)
- Ticket details (subject, description, type)
- Address information (if provided)
- Form metadata (form title, URL, etc.)
Smart field detection: looks for fields by ID first, then falls back to field names/types

3. Lookup Contact

Queries ITFlow API to check if the contact email already exists in your system
Uses the contacts/read.php endpoint

4. Contact Exists? (Conditional Branch)

If contact EXISTS (true path):
- Goes to "Set Existing IDs" node
- Retrieves the existing client_id and contact_id
- Skips to ticket creation
If contact DOESN'T EXIST (false path):
- Creates new client record
- Creates new contact record
- Sets the new IDs for ticket creation

5a. For Existing Contacts:

Set Existing IDs: Extracts client and contact IDs from the lookup result

5b. For New Contacts:

Create Client: Creates a new client record in ITFlow with:
- Client type: "Lead"
- Referral source: "Website Form - [Form Name]"
- Default rate: $90 CAD, Net 30 terms
Create Contact: Creates contact record linked to the new client
Set New IDs: Prepares the newly created IDs for ticket creation

6. Create Ticket (Final Step)

Creates a support ticket in ITFlow with:
- The parsed subject and details from the form
- Linked to the correct client and contact (whether existing or new)
- Priority: Low
- Status: Unassigned

Key Features

Smart Field Detection The parser is robust and can handle different WordPress form plugins and configurations by checking multiple field IDs and names.

Duplicate Prevention The workflow checks for existing contacts before creating new records, preventing duplicate entries in your system.

Flexible Form Support Handles various form fields including:

Standard contact info (name, email, phone)
Address fields
File uploads
Agreement/consent checkboxes
Custom ticket types

Automatic Classification

New submissions are marked as "Leads"
Referral source tracks which form was used
All automated entries are tagged with "created by webform automation"

Setup Requirements

To use this workflow, you'll need to:

Replace YOUR_API_KEY_HERE with your ITFlow API key
Replace YOUR-ITFLOW-DOMAIN with your ITFlow installation domain
Replace YOUR-WEBHOOK-ID-HERE with a unique webhook identifier
Configure your WordPress forms to POST to the webhook URL

API Reference

This workflow uses the ITFlow API endpoints for clients, contacts, and tickets.

{ "name": "Wordpress to ITFlow", "nodes": [ { "parameters": { "httpMethod": "POST", "path": "YOUR-WEBHOOK-ID-HERE", "options": {} }, "type": "n8n-nodes-base.webhook", "typeVersion": 2.1, "position": [-816, -208], "id": "32ccd401-b2fa-4098-bfa3-999d938c9129", "name": "Website Lead", "webhookId": "YOUR-WEBHOOK-ID-HERE" }, { "parameters": { "mode": "runOnceForEachItem", "jsCode": "// Robust parser for multiple WP form schemas (old + kiosk)\n// Works whether payload is at $json.body or $json directly\n\nconst src = $json.body ?? $json;\nconst formData = src.form_data ?? {};\n\nconst clean = (v) => {\n if (v === undefined || v === null) return '';\n if (typeof v === 'string') return v.trim();\n return v;\n};\n\n// Helpers\nconst firstNonEmpty = (...vals) => vals.find(v => {\n const c = clean(v);\n return (typeof c === 'string' ? c.length > 0 : !!c);\n}) ?? '';\n\nconst getFieldById = (id) => formData?.[String(id)];\nconst getFieldValue = (id) => getFieldById(id)?.value;\n\nconst findByName = (names = [], types = []) => {\n const wanted = names.map(n => String(n).toLowerCase());\n const tWanted = types.map(t => String(t).toLowerCase());\n for (const k of Object.keys(formData)) {\n const f = formData[k] || {};\n const nm = String(f.name ?? '').toLowerCase();\n const tp = String(f.type ?? '').toLowerCase();\n if ((wanted.length && wanted.includes(nm)) || (tWanted.length && tWanted.includes(tp))) {\n return f;\n }\n }\n return undefined;\n};\n\n// Name (support: old id 92, new id 72, or by name/type)\nconst nameField =\n getFieldById(92) ??\n getFieldById(72) ??\n findByName(['name'], ['name']);\n\nconst firstName = clean(nameField?.value?.first);\nconst lastName = clean(nameField?.value?.last);\nconst contact_name = `${firstName} ${lastName}`.trim();\n\n// Email (old 93, new 73, by name/type)\nconst emailField =\n getFieldById(93) ??\n getFieldById(73) ??\n findByName(['email', 'e-mail'], ['email']);\nconst contact_email = clean(emailField?.value);\n\n// Phone (old 96 or by name/type). Kiosk may not send it.\nconst phoneField =\n getFieldById(96) ??\n findByName(['phone','telephone','tel','mobile','cell'], ['phone','tel']);\nconst contact_phone = clean(phoneField?.value);\n\n// Subject (old 94 or by common names). Kiosk may lack it.\nconst subjectField =\n getFieldById(94) ??\n findByName(['subject','title']);\nconst ticket_subject = firstNonEmpty(\n clean(subjectField?.value),\n `Website Contact Form${src.form_title ? ` - ${clean(src.form_title)}` : ''}`\n);\n\n// Details / Issue (old 97, kiosk 75, or common names)\nconst detailsField =\n getFieldById(97) ??\n getFieldById(75) ??\n findByName(['issue','message','details','description','problem','body','notes']);\nconst ticket_details = firstNonEmpty(\n clean(detailsField?.value),\n clean(subjectField?.value),\n 'No details provided'\n);\n\n// Ticket type (old 98 or by name). Optional.\nconst typeField = getFieldById(98) ?? findByName(['type','category','topic']);\nconst ticket_type = clean(typeField?.value);\n\n// Address (old 95 structure). Optional.\nconst addr = getFieldById(95)?.value ?? {};\nconst address_line1 = clean(addr.line1);\nconst address_line2 = clean(addr.line2);\nconst address_city = clean(addr.city);\nconst address_state = clean(addr.state);\nconst address_zip = clean(addr.zip);\nconst address_country = clean(addr.country);\n\n// Upload URL (old 99). Optional.\nconst upload_url = clean(getFieldValue(99));\n\n// Agreement checkbox (old 103). Optional.\nconst ag = getFieldById(103)?.value ?? {};\nconst agreement_accepted = !!ag['0'];\nconst agreement_text = clean(ag['0']);\n\n// Compose address\nconst full_address = [address_line1, address_line2, address_city, address_state, address_zip, address_country]\n .filter(p => clean(p)).join(', ');\n\n// Output shape consumed by downstream nodes\nreturn {\n contact_name,\n first_name: firstName,\n last_name: lastName,\n contact_email,\n contact_phone,\n\n ticket_subject,\n ticket_details,\n ticket_type,\n\n address_line1,\n address_line2,\n address_city,\n address_state,\n address_zip,\n address_country,\n full_address,\n\n upload_url,\n agreement_accepted,\n agreement_text,\n\n // Back-compat for Create Client / Create Contact nodes\n client_name: contact_name,\n email: contact_email,\n issue: ticket_details,\n\n // Meta\n timestamp: new Date().toISOString(),\n form_id: clean(src.form_id),\n form_title: clean(src.form_title),\n form_url: clean(src.form_url)\n};\n" }, "type": "n8n-nodes-base.code", "typeVersion": 2, "position": [-624, -208], "id": "7e03239c-7ba3-43c6-94c3-cf4e6009fef6", "name": "Sort Data" }, { "parameters": { "url": "https://YOUR-ITFLOW-DOMAIN/api/v1/contacts/read.php", "sendQuery": true, "queryParameters": { "parameters": [ { "name": "api_key", "value": "YOUR_API_KEY_HERE" }, { "name": "contact_email", "value": "={{ $json.contact_email }}" } ] }, "options": {} }, "type": "n8n-nodes-base.httpRequest", "typeVersion": 4.2, "position": [-416, -208], "id": "8b80abd6-e708-4c07-9e7d-1abecb46db08", "name": "Lookup Contact" }, { "parameters": { "conditions": { "options": { "caseSensitive": true, "leftValue": "", "typeValidation": "strict", "version": 2 }, "conditions": [ { "id": "73cc5126-cecc-4ee5-9876-f60255053c56", "leftValue": "={{ $json.success }}", "rightValue": "True", "operator": { "type": "string", "operation": "equals", "name": "filter.operator.equals" } } ], "combinator": "and" }, "options": {} }, "type": "n8n-nodes-base.if", "typeVersion": 2.2, "position": [-224, -208], "id": "4c52d646-60b3-4afd-90b7-7da372ed5c0a", "name": "Contact Exists?" }, { "parameters": { "assignments": { "assignments": [ { "id": "a1b2c3d4", "name": "client_id", "value": "={{ $json.data[0].contact_client_id }}", "type": "string" }, { "id": "e5f6g7h8", "name": "ticket_contact_id", "value": "={{ $json.data[0].contact_id }}", "type": "string" }, { "id": "spreader", "name": "=", "value": "={{ $('Sort Data').item.json }}", "type": "object" } ] }, "options": {} }, "type": "n8n-nodes-base.set", "typeVersion": 3.4, "position": [-16, -304], "id": "8357da20-6e4d-4c9a-ab87-7a1b8b932e93", "name": "Set Existing IDs" }, { "parameters": { "method": "POST", "url": "https://YOUR-ITFLOW-DOMAIN/api/v1/clients/create.php", "sendHeaders": true, "headerParameters": { "parameters": [ { "name": "Content-Type", "value": "application/json" } ] }, "sendBody": true, "specifyBody": "json", "jsonBody": "={\n \"api_key\": \"YOUR_API_KEY_HERE\",\n \"client_name\": \"{{ $('Sort Data').item.json.client_name }}\",\n \"client_email\": \"{{ $('Sort Data').item.json.email }}\",\n \"client_type\": \"Lead\",\n \"client_website\": \"\",\n \"client_referral\": \"Website Form - {{ $('Sort Data').item.json.form_title }}\",\n \"client_rate\": \"90\",\n \"client_currency_code\": \"CAD\",\n \"client_net_terms\": \"30\",\n \"client_tax_id_number\": \"\",\n \"client_is_lead\": \"0\",\n \"client_notes\": \"created by webform automation\"\n}", "options": {} }, "type": "n8n-nodes-base.httpRequest", "typeVersion": 4.2, "position": [-16, -112], "id": "56c455d1-65a9-456e-91bb-9282cc78375a", "name": "Create Client" }, { "parameters": { "method": "POST", "url": "https://YOUR-ITFLOW-DOMAIN/api/v1/contacts/create.php", "sendBody": true, "specifyBody": "json", "jsonBody": "={\n \"api_key\": \"YOUR_API_KEY_HERE\",\n \"client_id\": \"{{ $('Create Client').item.json.data[0].insert_id }}\",\n \"contact_name\": \"{{ $('Sort Data').item.json.contact_name }}\",\n \"contact_title\": \"Web Lead\",\n \"contact_department\": \"\",\n \"contact_email\": \"{{ $('Sort Data').item.json.contact_email }}\",\n \"contact_phone\": \"{{ $('Sort Data').item.json.contact_phone }}\",\n \"contact_extension\": \"\",\n \"contact_mobile\": \"\",\n \"contact_notes\": \"created by webform automation\",\n \"contact_auth_method\": \"local\",\n \"contact_important\": \"0\",\n \"contact_billing\": \"0\",\n \"contact_technical\": \"0\",\n \"contact_location_id\": \"0\"\n}", "options": {} }, "type": "n8n-nodes-base.httpRequest", "typeVersion": 4.2, "position": [176, -112], "id": "6b8cd9d4-66d2-4ef9-8798-c80774a660f7", "name": "Create Contact" }, { "parameters": { "assignments": { "assignments": [ { "id": "i9j0k1l2", "name": "client_id", "value": "={{ $('Create Client').item.json.data[0].insert_id }}", "type": "string" }, { "id": "m3n4o5p6", "name": "ticket_contact_id", "value": "={{ $json.data[0].insert_id }}", "type": "string" }, { "id": "spreader2", "name": "=", "value": "={{ $('Sort Data').item.json }}", "type": "object" } ] }, "options": {} }, "type": "n8n-nodes-base.set", "typeVersion": 3.4, "position": [384, -112], "id": "4f6bdcf3-4cfa-415e-95b4-1aebc514bb8f", "name": "Set New IDs" }, { "parameters": { "method": "POST", "url": "https://YOUR-ITFLOW-DOMAIN/api/v1/tickets/create.php", "sendBody": true, "specifyBody": "json", "jsonBody": "={\n \"api_key\": \"YOUR_API_KEY_HERE\",\n \"client_id\": \"{{ $json.client_id }}\",\n \"ticket_contact_id\": \"{{ $json.ticket_contact_id }}\",\n \"ticket_subject\": \"{{ $('Sort Data').item.json.ticket_subject }}\",\n \"ticket_details\": \"{{ $('Sort Data').item.json.ticket_details }}\",\n \"ticket_priority\": \"Low\",\n \"ticket_assigned_to\": \"0\"\n}", "options": {} }, "type": "n8n-nodes-base.httpRequest", "typeVersion": 4.2, "position": [784, -208], "id": "1a6c36b6-098f-432c-a820-2740befff6aa", "name": "Create Ticket" } ], "connections": { "Website Lead": { "main": [[{"node": "Sort Data", "type": "main", "index": 0}]] }, "Sort Data": { "main": [[{"node": "Lookup Contact", "type": "main", "index": 0}]] }, "Lookup Contact": { "main": [[{"node": "Contact Exists?", "type": "main", "index": 0}]] }, "Contact Exists?": { "main": [ [{"node": "Set Existing IDs", "type": "main", "index": 0}], [{"node": "Create Client", "type": "main", "index": 0}] ] }, "Set Existing IDs": { "main": [[{"node": "Create Ticket", "type": "main", "index": 0}]] }, "Create Client": { "main": [[{"node": "Create Contact", "type": "main", "index": 0}]] }, "Create Contact": { "main": [[{"node": "Set New IDs", "type": "main", "index": 0}]] }, "Set New IDs": { "main": [[{"node": "Create Ticket", "type": "main", "index": 0}]] } }, "active": true, "settings": { "executionOrder": "v1", "saveExecutionProgress": true, "callerPolicy": "workflowsFromSameOwner" } }

focusflarenetwork

digibandit so this only works if your using wordpress for your website then? I am more looking for a n8n where if a customer calls in the ai phone bot used the api from ITflow to create a new ticket for me

digibandit

focusflarenetwork Well, that's what I made my workflow to do, but you can import this and edit to your needs.

So, for example, you would swap out my contact form webhook step with your ai phone webhook and change the Sort Data step to accommodate for your data, then enter in your api creds and (as far as i am aware) you should be good to go!

focusflarenetwork

digibandit you sir are a genius!!! I just figured out how to import it into n8n lol. So my think that I am still confused on is https://YOUR-ITFLOW-DOMAIN/api/v1/contacts/read.php

there isnt a site for this? I know I need to replace it with my domain but when I do replace it with my domain how does it know to go to that php? I am still stupid beginner at all of this but if this works my God, you will be my hero. Been trying to get something like this to work for months now

digibandit

focusflarenetwork
https://docs.itflow.org/api

if your itflow url is demo.itflow.org, then https://YOUR-ITFLOW-DOMAIN/api/v1/contacts/read.php would be https://demo.itflow.org/api/v1/contacts/read.php

focusflarenetwork

digibandit right but it doesn’t do the best at explaining that. So you just knew you wanted n8n to make a contact so you got the api key from it flow and then you just replaced the domain with your domain ie: tickets.focusflarenetwork.com and know that you wanted to contact so you found its php? I guess my question is how did you figure out where to get the contacts/read.php

digibandit

focusflarenetwork I last updated that page in June so it's probs due for a refresh.

focusflarenetwork right but it doesn’t do the best at explaining that

The API docs? No, they don't. Working on that!

focusflarenetwork So you just knew you wanted n8n to make a contact

Found it out as i went. I started from "i want to make a ticket when someone fills out this form' to what it is now.

focusflarenetwork so you got the api key from it flow and then you just replaced the domain with your domain ie: tickets.focusflarenetwork.com and know that you wanted to contact so you found its php?

I think you are having a stroke. or i am… 🔥🍞

Yes? … Maybe…

focusflarenetwork how did you figure out where to get the contacts/read.php

itflow-org/itflowtree/master/api/v1

itflow-org/itflow-api-powershell

focusflarenetwork Seems way easier than I expected from last time yeepie

That's the power of taking a break and coming back around to it 😉

focusflarenetwork

Nevermind, I guess they updated the api page since last i checked. yeeepppepepepeeieieieiiewfiehwqfheiiihehiieeie. Seems way easier than I expected from last time yeepie

focusflarenetwork

digibandit focusflarenetwork so you got the api key from it flow and then you just replaced the domain with your domain ie: tickets.focusflarenetwork.com and know that you wanted to contact so you found its php?

I think you are having a stroke. or i am… 🔥🍞

Yes? … Maybe…

I honestly have ZERO clue of what I am doing when it comes to coding so it’s likely a stroke for sure. I also barely understand what and how an api key works honestly. I dont think I am asking the right question but the good news is the documentation as of now kind of does a better job at explaining. Before when I tried I didnt see

The current version of the ITFlow API is v1. It can be accessed at itflow.example.com/api/v1/{module}/{function}.php

And then it does explain a little bit on how to do this which is nice. But you bridged how to connect it flow to n8n which is exactly what I have been wanting. I had to go to zammad and I really didnt want to. Zammad also didnt work so I gave up and went to slack and that also didnt work the way I wanted lol so I am praying that what I need will work now

focusflarenetwork

digibandit

Damn only one issue I thought about. For my SSL I use cloud flares tunneling cus I cant stand nginx. When doing the installer script I assume I put none for the ssl section. But will this effect the api key thing from working?

digibandit

focusflarenetwork ¯\(ツ)/¯

Only way to find out is to try!

focusflarenetwork

digibandit

ya I guess it doesnt work because I cant even connect to it via ip either. isnt it "yourip"/setup.php?

focusflarenetwork

@digibandit you are an absolute genius and I finally came back home to Itflow because n8n worked BUT it doesnt output any of the call information

focusflarenetwork

but no joke literally overjoyed I even got to this. I just need help with tweaking it further. once it actually creates the ticket accurately, it will help my business so much.

How can I pay for support

Bigbug

focusflarenetwork How can I pay for support

https://services.itflow.org/